A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10015
Swiss-prot Accession number	Q9PUR1 (Sequence in FASTA format)
Description	Glucagon-1 precursor [Contains: Glucagon-1 (Glucagon I); Glucagon-likepeptide 1-I (GLP-1I); Glucagon-like peptide 2-I (GLP-2I)].
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	160 Amino acids
Molecular weight	18042
References	1  PubMed abstract 10555286 2  PubMed abstract 8405897
Domain Name	Hormone_2
Hormone Name	Glucagon-1
Mature Hormone Sequence	HSEGTFTSDYSKYLENKQAKDFVRWLMNA
Position of mature hormone in Pre-Hormone protein	29 Residues from position (43-71)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10249
Swiss-prot Accession number	Q9PUR1 (Sequence in FASTA format)
Description	Glucagon-1 precursor [Contains: Glucagon-1 (Glucagon I); Glucagon-likepeptide 1-I (GLP-1I); Glucagon-like peptide 2-I (GLP-2I)].
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	160 Amino acids
Molecular weight	18042
References	1  PubMed abstract 10555286 2  PubMed abstract 8405897
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 1-I
Mature Hormone Sequence	HADGTFTNDMTSYLDAKAARDFVSWLARSDKS
Position of mature hormone in Pre-Hormone protein	32 Residues from position (82-113)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10250
Swiss-prot Accession number	Q9PUR1 (Sequence in FASTA format)
Description	Glucagon-1 precursor [Contains: Glucagon-1 (Glucagon I); Glucagon-likepeptide 1-I (GLP-1I); Glucagon-like peptide 2-I (GLP-2I)].
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	160 Amino acids
Molecular weight	18042
References	1  PubMed abstract 10555286 2  PubMed abstract 8405897
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2-I
Mature Hormone Sequence	HAEDVNALLDRTMAKTFIEWLEKQNSNDQTD
Position of mature hormone in Pre-Hormone protein	31 Residues from position (130-160)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10254
Swiss-prot Accession number	Q9PUR0 (Sequence in FASTA format)
Description	Glucagon-2 precursor [Contains: Glucagon-2 (Glucagon II) (Glu II);Glucagon-like peptide 2-II (GLP-2II)].
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level
Protein Length	120 Amino acids
Molecular weight	13397
References	1  PubMed abstract 10555286
Domain Name	Hormone_2
Hormone Name	Glucagon-2
Mature Hormone Sequence	HSQGSFTSDYSKHLDVKQAKDFVTWLLNT
Position of mature hormone in Pre-Hormone protein	29 Residues from position (44-72)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10255
Swiss-prot Accession number	Q9PUR0 (Sequence in FASTA format)
Description	Glucagon-2 precursor [Contains: Glucagon-2 (Glucagon II) (Glu II);Glucagon-like peptide 2-II (GLP-2II)].
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13397
References	1  PubMed abstract 10555286
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2-II
Mature Hormone Sequence	HSDGSFTNDMNVMLDRMSAKNFLEWLKQQGRG
Position of mature hormone in Pre-Hormone protein	32 Residues from position (89-120)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10409
Swiss-prot Accession number	P04378 (Sequence in FASTA format)
Description	Gonadoliberin-1 (Gonadoliberin I) (Gonadotropin-releasing hormone I)(GnRH-I) (Luliberin I).
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones
Protein Length	10 Amino acids
Molecular weight	1244
References	1  PubMed abstract 3514603
Domain Name	N/A
Hormone Name	Gonadoliberin-1
Mature Hormone Sequence	QHYSLEWKPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (1-10)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10452
Swiss-prot Accession number	P30948 (Sequence in FASTA format)
Description	Gonadoliberin-3 (Gonadoliberin III) (Gonadotropin-releasing hormoneIII) (GnRH-III) (Luliberin III).
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones
Protein Length	10 Amino acids
Molecular weight	1277
References	1  PubMed abstract 8440174
Domain Name	N/A
Hormone Name	Gonadoliberin-3
Mature Hormone Sequence	QHWSHDWKPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (1-10)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10875
Swiss-prot Accession number	P68987 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	57 Amino acids
Molecular weight	6207
References	1  PubMed abstract 3282977
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	SALTGAGGTHLCGSHLVEALYVVCGDRGFFYTPSKT
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10876
Swiss-prot Accession number	P68987 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	57 Amino acids
Molecular weight	6207
References	1  PubMed abstract 3282977
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHRKCSIYDMENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (37-57)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	11145
Swiss-prot Accession number	P21779 (Sequence in FASTA format)
Description	Somatostatin-37 [Contains: Somatostatin-34; Somatostatin-14].
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	37 Amino acids
Molecular weight	4039
References	1  PubMed abstract 2902094
Domain Name	Somatostatin
Hormone Name	Somatostatin-34
Mature Hormone Sequence	AAAVAGSPQQLLPLGQRERKAGCKNFFWKTFSSC
Position of mature hormone in Pre-Hormone protein	34 Residues from position (4-37)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	11146
Swiss-prot Accession number	P21779 (Sequence in FASTA format)
Description	Somatostatin-37 [Contains: Somatostatin-34; Somatostatin-14].
Source organism	Petromyzon marinus (Sea lamprey)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	37 Amino acids
Molecular weight	4039
References	1  PubMed abstract 2902094
Domain Name	Somatostatin
Hormone Name	Somatostatin-14
Mature Hormone Sequence	AGCKNFFWKTFSSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (24-37)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated